General Information

  • ID:  hor005591
  • Uniprot ID:  Q8UW81
  • Protein name:  GnRH-associated peptide 2
  • Gene name:  gnrh2
  • Organism:  Verasper moseri (Barfin flounder)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  Midbrain tegmentum.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Verasper (genus), Pleuronectidae (family), Pleuronectoidei (suborder), Pleuronectiformes (order), Carangaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  ELDSFGTSEISEEIKLCEAGECSYLRPQRRNILRNILLDALARELQKRK
  • Length:  49
  • Propeptide:  MCASRLVLLLGLLLCVGAHLSSGQHWSHGWYPGGKRELDSFGTSEISEEIKLCEAGECSYLRPQRRNILRNILLDALARELQKRK
  • Signal peptide:  MCASRLVLLLGLLLCVGAHLSSG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O73811-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005591_AF2.pdbhor005591_ESM.pdb

Physical Information

Mass: 656289 Formula: C245H412N74O78S2
Absent amino acids: HMVW Common amino acids: L
pI: 6.54 Basic residues: 9
Polar residues: 12 Hydrophobic residues: 16
Hydrophobicity: -61.63 Boman Index: -14006
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 101.63
Instability Index: 10988.37 Extinction Coefficient cystines: 1615
Absorbance 280nm: 33.65

Literature

  • PubMed ID:  12093120
  • Title:  Molecular cloning of three cDNAs encoding different GnRHs in the brain of barfin flounder.